OR2W5 antibody (Middle Region)

Catalog No. ABIN635348

The Rabbit Polyclonal anti-OR2W5 antibody is suitable to detect OR2W5 in samples from Human. It has been validated for WB.

Quick Overview for OR2W5 antibody (Middle Region) (ABIN635348)

Target: OR2W5 (Olfactory Receptor, Family 2, Subfamily W, Member 5 (OR2W5))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This OR2W5 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-OR2W5 Antibody

Binding Specificity: Middle Region

Specificity: OR2 W5 antibody was raised against the middle region of OR2 5

Purification: Affinity purified

Immunogen: OR2 W5 antibody was raised using the middle region of OR2 5 corresponding to a region with amino acids SGEVPDSLLHHRHSQHQPPHLHFEEQGCEGDHEETSGVGERGWGASTRGT

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

OR2W5 Blocking Peptide, (ABIN5615141), is also available for use as a blocking control in assays to test for specificity of this OR2W5 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OR0 5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for OR2W5

Target: OR2W5 (Olfactory Receptor, Family 2, Subfamily W, Member 5 (OR2W5))

Alternative Name: OR2W5

Background: Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms.

Molecular Weight: 35 kDa (MW of target protein)