C19orf28 antibody (Middle Region)
-
- Target See all C19orf28 products
- C19orf28 (Chromosome 19 Open Reading Frame 28 (C19orf28))
-
Binding Specificity
- Middle Region
- Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This C19orf28 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificity
- C19 ORF28 antibody was raised against the middle region of C19 rf28
- Purification
- Affinity purified
- Immunogen
- C19 ORF28 antibody was raised using the middle region of C19 rf28 corresponding to a region with amino acids VELTALRYAFTVVANITVYGAAWLLLHLQGSSRVEPTQDISISDQLGGQD
-
-
- Application Notes
-
WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
C19ORF28 Blocking Peptide, catalog no. 33R-9502, is also available for use as a blocking control in assays to test for specificity of this C19ORF28 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF28 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- C19orf28 (Chromosome 19 Open Reading Frame 28 (C19orf28))
- Alternative Name
- C19ORF28 (C19orf28 Products)
- Background
- The function of this gene remains unknown.
- Molecular Weight
- 51 kDa (MW of target protein)
-