Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

C19orf28 antibody (Chromosome 19 Open Reading Frame 28) (Middle Region) Primary Antibody

C19orf28 Reactivity: Human IHC, WB Host: Rabbit Polyclonal unconjugated
Catalog No. ABIN635358
$647.32
Plus shipping costs $45.00
50 μg
local_shipping Shipping to: United States
Delivery in 9 to 11 Business Days
  • Target
    C19orf28
    Binding Specificity
    Middle Region
    • 2
    • 1
    Reactivity
    Human
    • 19
    • 1
    • 1
    Host
    Rabbit
    Clonality
    Polyclonal
    Conjugate
    This C19orf28 antibody is un-conjugated
    • 5
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Application
    Immunohistochemistry (IHC), Western Blotting (WB)
    • 13
    • 7
    • 3
    • 2
    • 1
    Specificity
    C19 ORF28 antibody was raised against the middle region of C19 rf28
    Purification
    Affinity purified
    Immunogen
    C19 ORF28 antibody was raised using the middle region of C19 rf28 corresponding to a region with amino acids VELTALRYAFTVVANITVYGAAWLLLHLQGSSRVEPTQDISISDQLGGQD
  • Application Notes
    WB: 0.5 µg/mL, IHC: 4-8 µg/mL
    Optimal conditions should be determined by the investigator.
    Comment

    C19ORF28 Blocking Peptide, catalog no. 33R-9502, is also available for use as a blocking control in assays to test for specificity of this C19ORF28 antibody

    Restrictions
    For Research Use only
  • Format
    Lyophilized
    Reconstitution
    Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF28 antibody in PBS
    Concentration
    Lot specific
    Buffer
    PBS
    Handling Advice
    Avoid repeated freeze/thaw cycles.
    Dilute only prior to immediate use.
    Storage
    4 °C
    Storage Comment
    Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
  • Target
    C19orf28
    Alternative Name
    C19ORF28 ()
    Synonyms
    MGC81076, C19orf28, PP3501, F630110N24Rik, Wdt1, major facilitator superfamily domain containing 12 L homeolog, major facilitator superfamily domain containing 12, mfsd12.L, mfsd12, MFSD12, Mfsd12
    Background
    The function of this gene remains unknown.
    Molecular Weight
    51 kDa (MW of target protein)
You are here:
help Support