C19orf28 antibody (Chromosome 19 Open Reading Frame 28) (Middle Region)

Details for Product anti-C19orf28 Antibody No. ABIN635358
Antigen
Epitope
Middle Region
5
1
Reactivity
Human
22
1
1
Host
Rabbit
22
Clonality
Polyclonal
Conjugate
This C19orf28 antibody is un-conjugated
1
1
1
1
1
1
1
1
1
1
1
1
1
1
Application
Immunohistochemistry (IHC), Western Blotting (WB)
13
10
3
2
1
Options
Immunogen C19 ORF28 antibody was raised using the middle region of C19 rf28 corresponding to a region with amino acids VELTALRYAFTVVANITVYGAAWLLLHLQGSSRVEPTQDISISDQLGGQD
Specificity C19 ORF28 antibody was raised against the middle region of C19 rf28
Purification Affinity purified
Antigen
Alternative Name C19ORF28
Background The function of this gene remains unknown.
Molecular Weight 51 kDa (MW of target protein)
Application Notes WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.
Comment

C19ORF28 Blocking Peptide, catalog no. 33R-9502, is also available for use as a blocking control in assays to test for specificity of this C19ORF28 antibody

Restrictions For Research Use only
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF28 antibody in PBS
Concentration Lot specific
Buffer PBS
Handling Advice Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Storage 4 °C
Storage Comment Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Supplier Images
Image no. 1 for anti-Chromosome 19 Open Reading Frame 28 (C19orf28) (Middle Region) antibody (ABIN635358) C19ORF28 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml t...
Image no. 2 for anti-Chromosome 19 Open Reading Frame 28 (C19orf28) (Middle Region) antibody (ABIN635358) C19ORF28 antibody used at 0.5 ug/ml to detect target protein.