SLC25A25 antibody

Catalog No. ABIN635360

The Rabbit Polyclonal anti-SLC25A25 antibody has been validated for WB. It is suitable to detect SLC25A25 in samples from Human, Rat, Mouse and Dog.

Quick Overview for SLC25A25 antibody (ABIN635360)

Target: SLC25A25 (Solute Carrier Family 25 (Mitochondrial Carrier, Phosphate Carrier), Member 25 (SLC25A25))

Reactivity: Human, Rat, Mouse, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLC25A25 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-SLC25A25 Antibody

Purification: Affinity purified

Immunogen: SLC25 A25 antibody was raised using a synthetic peptide corresponding to a region with amino acids AVGLRRLGLHRTEGELQKIVQAGDKDLDGQLDFEEFVHYLQDHEKKLRLV

Application Details

Application Notes: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLC25A25 Blocking Peptide, (ABIN936982), is also available for use as a blocking control in assays to test for specificity of this SLC25A25 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 25 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SLC25A25

Target: SLC25A25 (Solute Carrier Family 25 (Mitochondrial Carrier, Phosphate Carrier), Member 25 (SLC25A25))

Alternative Name: SLC25A25

Background: SLC25A25 is a calcium-dependent mitochondrial solute carrier. Mitochondrial solute carriers shuttle metabolites, nucleotides, and cofactors through the mitochondrial inner membrane.

Molecular Weight: 55 kDa (MW of target protein)