SLC25A25 antibody
-
- Target See all SLC25A25 Antibodies
- SLC25A25 (Solute Carrier Family 25 (Mitochondrial Carrier, Phosphate Carrier), Member 25 (SLC25A25))
-
Reactivity
- Human, Rat, Mouse, Dog
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SLC25A25 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- SLC25 A25 antibody was raised using a synthetic peptide corresponding to a region with amino acids AVGLRRLGLHRTEGELQKIVQAGDKDLDGQLDFEEFVHYLQDHEKKLRLV
- Top Product
- Discover our top product SLC25A25 Primary Antibody
-
-
- Application Notes
-
WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SLC25A25 Blocking Peptide, catalog no. 33R-1596, is also available for use as a blocking control in assays to test for specificity of this SLC25A25 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 25 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLC25A25 (Solute Carrier Family 25 (Mitochondrial Carrier, Phosphate Carrier), Member 25 (SLC25A25))
- Alternative Name
- SLC25A25 (SLC25A25 Products)
- Background
- SLC25A25 is a calcium-dependent mitochondrial solute carrier. Mitochondrial solute carriers shuttle metabolites, nucleotides, and cofactors through the mitochondrial inner membrane.
- Molecular Weight
- 55 kDa (MW of target protein)
-