SLC27A6 antibody

Catalog No. ABIN635364

The Rabbit Polyclonal anti-SLC27A6 antibody (ABIN635364) specifically detects SLC27A6 in WB. The antibody is reactive with Human, Mouse and Rat samples.

Quick Overview for SLC27A6 antibody (ABIN635364)

Target: SLC27A6 (Solute Carrier Family 27 (Fatty Acid Transporter), Member 6 (SLC27A6))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLC27A6 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-SLC27A6 Antibody

Purification: Affinity purified

Immunogen: SLC27 A6 antibody was raised using a synthetic peptide corresponding to a region with amino acids KSTCLYIFTSGTTGLPKAAVISQLQVLRGSAVLWAFGCTAHDIVYITLPL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLC27A6 Blocking Peptide, (ABIN940051), is also available for use as a blocking control in assays to test for specificity of this SLC27A6 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SLC27A6

Target: SLC27A6 (Solute Carrier Family 27 (Fatty Acid Transporter), Member 6 (SLC27A6))

Alternative Name: SLC27A6

Background: SLC27A6 is a member of the fatty acid transport protein family (FATP). FATPs are involved in the uptake of long-chain fatty acids and have unique expression patterns. Alternatively spliced transcript variants encoding the same protein have been found for this gene.

Molecular Weight: 70 kDa (MW of target protein)