Podoplanin antibody (N-Term)

Catalog No. ABIN635389

This Rabbit Polyclonal antibody specifically detects Podoplanin in WB and IHC. It exhibits reactivity toward Human.

Quick Overview for Podoplanin antibody (N-Term) (ABIN635389)

Target: Podoplanin (PDPN)

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Podoplanin antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-Podoplanin Antibody

Binding Specificity: N-Term

Specificity: Podoplanin antibody was raised against the N terminal of PDPN

Purification: Affinity purified

Immunogen: Podoplanin antibody was raised using the N terminal of PDPN corresponding to a region with amino acids EGASTGQPEDDTETTGLEGGVAMPGAEDDVVTPGTSEDRYKSGLTTLVAT

Application Details

Application Notes: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Podoplanin Blocking Peptide, (ABIN937806), is also available for use as a blocking control in assays to test for specificity of this Podoplanin antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PDPN antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Podoplanin

Target: Podoplanin (PDPN)

Alternative Name: Podoplanin

Background: PDPN is a type-I integral membrane glycoprotein with diverse distribution in human tissues. The physiological function of this protein may be related to its mucin-type character. The homologous protein in other species has been described as a differentiation antigen and influenza-virus receptor. The specific function of this protein has not been determined but it has been proposed as a marker of lung injury.

Molecular Weight: 25 kDa (MW of target protein)

Pathways: Dicarboxylic Acid Transport