C20orf30 antibody (C-Term)

Catalog No. ABIN635395

This Rabbit Polyclonal antibody specifically detects C20orf30 in WB. It exhibits reactivity toward Human, Rat and Mouse.

Quick Overview for C20orf30 antibody (C-Term) (ABIN635395)

Target: C20orf30 (Chromosome 20 Open Reading Frame 30 (C20orf30))

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This C20orf30 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-C20orf30 Antibody

Binding Specificity: C-Term

Specificity: C20 ORF30 antibody was raised against the C terminal Of C20 rf30

Purification: Affinity purified

Immunogen: C20 ORF30 antibody was raised using the C terminal Of C20 rf30 corresponding to a region with amino acids KGGADRAVPVLIIGILVFLPGFYHLRIAYYASKGYRGYSYDDIPDFDD

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C20ORF30 Blocking Peptide, (ABIN939777), is also available for use as a blocking control in assays to test for specificity of this C20ORF30 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C20 RF30 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for C20orf30

Target: C20orf30 (Chromosome 20 Open Reading Frame 30 (C20orf30))

Alternative Name: C20ORF30

Background: The function of C20orf30 protein has not been widely studied, and is yet to be fully elucidated.

Molecular Weight: 13 kDa (MW of target protein)