Chromosome 1 Open Reading Frame 151 (C1orf151) (Middle Region) antibody

Details for Product No. ABIN635405
Antigen
Epitope
Middle Region
1
1
1
Reactivity
Human, Mouse (Murine)
7
7
4
2
2
2
1
1
Host
Rabbit
7
1
Clonality
Polyclonal
Conjugate
Un-conjugated
1
1
Application
Western Blotting (WB)
5
3
1
1
1
Options
Immunogen C1 ORF151 antibody was raised using the middle region of C1 rf151 corresponding to a region with amino acids IVFSLTFFKRRMWPLAFGSGMGLGMAYSNCQHDFQAPYLLHGKYVKEQEQ
Specificity C1 ORF151 antibody was raised against the middle region of C1 rf151
Purification Affinity purified
Antigen
Alternative Name C1ORF151 (C1orf151 Antibody Abstract)
Background The function of C1orf151 protein has not been widely studied, and is yet to be fully elucidated.
Molecular Weight 9 kDa (MW of target protein)
Application Notes WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Comment

C1ORF151 Blocking Peptide, catalog no. 33R-4197, is also available for use as a blocking control in assays to test for specificity of this C1ORF151 antibody

Restrictions For Research Use only
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF151 antibody in PBS
Concentration Lot specific
Buffer PBS
Handling Advice Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Storage 4 °C
Storage Comment Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Supplier Images
Image no. 1 for anti-Chromosome 1 Open Reading Frame 151 (C1orf151) (Middle Region) antibody (ABIN635405) C1ORF151 antibody used at 1 ug/ml to detect target protein.