Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

Chromosome 1 Open Reading Frame 151 (C1orf151) (Middle Region) antibody Primary Antibody

C1orf151 Reactivity: Human, Mouse WB Host: Rabbit Polyclonal unconjugated
Catalog No. ABIN635405
$647.32
Plus shipping costs $45.00
50 μg
local_shipping Shipping to: United States
Delivery in 9 to 11 Business Days
  • Target
    Chromosome 1 Open Reading Frame 151 (C1orf151)
    Binding Specificity
    Middle Region
    • 2
    • 1
    • 1
    • 1
    Reactivity
    Human, Mouse
    • 8
    • 7
    • 4
    • 2
    • 2
    • 2
    • 1
    • 1
    Host
    Rabbit
    Clonality
    Polyclonal
    Conjugate
    Un-conjugated
    • 7
    • 1
    • 1
    Application
    Western Blotting (WB)
    • 6
    • 3
    • 1
    • 1
    • 1
    Specificity
    C1 ORF151 antibody was raised against the middle region of C1 rf151
    Purification
    Affinity purified
    Immunogen
    C1 ORF151 antibody was raised using the middle region of C1 rf151 corresponding to a region with amino acids IVFSLTFFKRRMWPLAFGSGMGLGMAYSNCQHDFQAPYLLHGKYVKEQEQ
  • Application Notes
    WB: 1 µg/mL
    Optimal conditions should be determined by the investigator.
    Comment

    C1ORF151 Blocking Peptide, catalog no. 33R-4197, is also available for use as a blocking control in assays to test for specificity of this C1ORF151 antibody

    Restrictions
    For Research Use only
  • Format
    Lyophilized
    Reconstitution
    Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF151 antibody in PBS
    Concentration
    Lot specific
    Buffer
    PBS
    Handling Advice
    Avoid repeated freeze/thaw cycles.
    Dilute only prior to immediate use.
    Storage
    4 °C
    Storage Comment
    Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
  • Target
    Chromosome 1 Open Reading Frame 151 (C1orf151)
    Alternative Name
    C1ORF151 (C1orf151 Antibody Abstract)
    Synonyms
    C1orf151, MIO10, RGD1560187, 2310028O11Rik, mitochondrial inner membrane organizing system 1, MINOS1, Minos1
    Background
    The function of C1orf151 protein has not been widely studied, and is yet to be fully elucidated.
    Molecular Weight
    9 kDa (MW of target protein)
You are here:
help Support