YIF1B antibody

Catalog No. ABIN635410

This Rabbit Polyclonal antibody specifically detects YIF1B in WB. It exhibits reactivity toward Human, Rat and Mouse.

Quick Overview for YIF1B antibody (ABIN635410)

Target: YIF1B (Yip1 Interacting Factor Homolog B (YIF1B))

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This YIF1B antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-YIF1B Antibody

Purification: Affinity purified

Immunogen: YIF1 B antibody was raised using a synthetic peptide corresponding to a region with amino acids LGTQDRFSPDLLGLQASSALAWLTLEVLAILLSLYLVTVNTDLTTIDLVA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

YIF1B Blocking Peptide, (ABIN940384), is also available for use as a blocking control in assays to test for specificity of this YIF1B antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of YIF0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for YIF1B

Target: YIF1B (Yip1 Interacting Factor Homolog B (YIF1B))

Alternative Name: YIF1B

Background: YIF1B belongs to the YIF1 family. It is a multi-pass membrane protein. The functions of YIF1B remain unknown.

Molecular Weight: 31 kDa (MW of target protein)