SEC63 antibody
-
- Target See all SEC63 Antibodies
- SEC63 (SEC63 Homolog (SEC63))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SEC63 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- SEC63 antibody was raised using a synthetic peptide corresponding to a region with amino acids WPRDQNAEQIRLKNIRKVYGRCMWYRLRLLKPQPNIIPTVKKIVLLAGWA
- Top Product
- Discover our top product SEC63 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SEC63 Blocking Peptide, catalog no. 33R-9989, is also available for use as a blocking control in assays to test for specificity of this SEC63 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SEC63 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SEC63 (SEC63 Homolog (SEC63))
- Alternative Name
- SEC63 (SEC63 Products)
- Background
- The Sec61 complex is the central component of the protein translocation apparatus of the endoplasmic reticulum (ER) membrane. SEC63 and SEC62 protein are found to be associated with ribosome-free SEC61 complex.
- Molecular Weight
- 88 kDa (MW of target protein)
- Pathways
- ER-Nucleus Signaling
-