SEC63 antibody

Catalog No. ABIN635435

The Rabbit Polyclonal anti-SEC63 antibody has been validated for WB. It is suitable to detect SEC63 in samples from Human, Mouse and Rat.

Quick Overview for SEC63 antibody (ABIN635435)

Target: SEC63 (SEC63 Homolog (SEC63))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SEC63 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-SEC63 Antibody

Purification: Affinity purified

Immunogen: SEC63 antibody was raised using a synthetic peptide corresponding to a region with amino acids WPRDQNAEQIRLKNIRKVYGRCMWYRLRLLKPQPNIIPTVKKIVLLAGWA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SEC63 Blocking Peptide, (ABIN5616032), is also available for use as a blocking control in assays to test for specificity of this SEC63 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SEC63 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SEC63

Target: SEC63 (SEC63 Homolog (SEC63))

Alternative Name: SEC63

Background: The Sec61 complex is the central component of the protein translocation apparatus of the endoplasmic reticulum (ER) membrane. SEC63 and SEC62 protein are found to be associated with ribosome-free SEC61 complex.

Molecular Weight: 88 kDa (MW of target protein)

Pathways: ER-Nucleus Signaling