Cysteine-Rich Hydrophobic Domain 2 (CHIC2) (N-Term) antibody

Details for Product No. ABIN635436
Antigen
  • zgc:55670
  • BTL
  • 1700081B18Rik
  • 4930502K01Rik
  • cysteine rich hydrophobic domain 2
  • cysteine-rich hydrophobic domain 2
  • cysteine rich hydrophobic domain 2 S homeolog
  • CHIC2
  • CpipJ_CPIJ013126
  • chic2
  • chic2.S
  • Chic2
Epitope
N-Term
9
9
8
6
2
Reactivity
Human, Mouse (Murine), Rat (Rattus), Dog (Canine)
32
21
10
4
4
4
3
2
2
2
2
1
1
1
Host
Rabbit
32
Clonality
Polyclonal
Conjugate
Un-conjugated
2
2
2
2
2
2
Application
Immunohistochemistry (IHC), Western Blotting (WB)
29
17
9
2
1
Options
Immunogen CHIC2 antibody was raised using the N terminal of CHIC2 corresponding to a region with amino acids EEQLLKYSPDPVVVRGSGHVTVFGLSNKFESEFPSSLTGKVAPEEFKASI
Specificity CHIC2 antibody was raised against the N terminal of CHIC2
Purification Affinity purified
Antigen
Alternative Name CHIC2 (CHIC2 Antibody Abstract)
Background CHIC2 is a member of the CHIC family of proteins. This protein contains a cysteine-rich hydrophobic (CHIC) motif, and is localized to vesicular structures and the plasma membrane. CHIC2 gene is associated with some cases of acute myeloid leukemia.
Molecular Weight 19 kDa (MW of target protein)
Application Notes WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.
Comment

CHIC2 Blocking Peptide, catalog no. 33R-2382, is also available for use as a blocking control in assays to test for specificity of this CHIC2 antibody

Restrictions For Research Use only
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHIC2 antibody in PBS
Concentration Lot specific
Buffer PBS
Handling Advice Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Storage 4 °C
Storage Comment Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Supplier Images
Image no. 1 for anti-Cysteine-Rich Hydrophobic Domain 2 (CHIC2) (N-Term) antibody (ABIN635436) CHIC2 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to s...
Image no. 2 for anti-Cysteine-Rich Hydrophobic Domain 2 (CHIC2) (N-Term) antibody (ABIN635436) CHIC2 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Mag...
Image no. 3 for anti-Cysteine-Rich Hydrophobic Domain 2 (CHIC2) (N-Term) antibody (ABIN635436) CHIC2 antibody used at 0.25 ug/ml to detect target protein.
Did you look for something else?