SYNGR4 antibody (N-Term)
-
- Target See all SYNGR4 Antibodies
- SYNGR4 (Synaptogyrin 4 (SYNGR4))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SYNGR4 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- Synaptogyrin 4 antibody was raised against the N terminal of SYNGR4
- Purification
- Affinity purified
- Immunogen
- Synaptogyrin 4 antibody was raised using the N terminal of SYNGR4 corresponding to a region with amino acids MHIPKSLQELANSEAVQFLRRPKTITRVFEGVFSLIVFSSLLTDGYQNKM
- Top Product
- Discover our top product SYNGR4 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Synaptogyrin 4 Blocking Peptide, catalog no. 33R-6093, is also available for use as a blocking control in assays to test for specificity of this Synaptogyrin 4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SYNGR4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SYNGR4 (Synaptogyrin 4 (SYNGR4))
- Alternative Name
- Synaptogyrin 4 (SYNGR4 Products)
- Background
- SYNGR4 is an integral membrane protein. The gene belongs to the synaptogyrin gene family. Like other members of the family the protein contains four transmembrane regions. The exact function of this protein is unclear.
- Molecular Weight
- 26 kDa (MW of target protein)
-