Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

Chromosome 19 Open Reading Frame 56 (C19orf56) (N-Term) antibody Primary Antibody

C19orf56 Reactivity: Human, Mouse, Rat WB Host: Rabbit Polyclonal unconjugated
Catalog No. ABIN635449
$647.32
Plus shipping costs $45.00
50 μg
local_shipping Shipping to: United States
Delivery in 9 to 11 Business Days
  • Target
    Chromosome 19 Open Reading Frame 56 (C19orf56)
    Binding Specificity
    N-Term
    Reactivity
    Human, Mouse, Rat
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    Host
    Rabbit
    Clonality
    Polyclonal
    Application
    Western Blotting (WB)
    Specificity
    C19 ORF56 antibody was raised against the N terminal Of C19 rf56
    Purification
    Affinity purified
    Immunogen
    C19 ORF56 antibody was raised using the N terminal Of C19 rf56 corresponding to a region with amino acids STNNMSDPRRPNKVLRYKPPPSECNPALDDPTPDYMNLLGMIFSMCGLML
  • Application Notes
    WB: 1 µg/mL
    Optimal conditions should be determined by the investigator.
    Comment

    C19ORF56 Blocking Peptide, catalog no. 33R-8878, is also available for use as a blocking control in assays to test for specificity of this C19ORF56 antibody

    Restrictions
    For Research Use only
  • Format
    Lyophilized
    Reconstitution
    Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF56 antibody in PBS
    Concentration
    Lot specific
    Buffer
    PBS
    Handling Advice
    Avoid repeated freeze/thaw cycles.
    Dilute only prior to immediate use.
    Storage
    4 °C
    Storage Comment
    Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
  • Target
    Chromosome 19 Open Reading Frame 56 (C19orf56)
    Alternative Name
    C19ORF56 ()
    Synonyms
    MGC81480, C19orf56, PTD008, C7H19orf56, WD repeat domain 83 opposite strand L homeolog, WD repeat domain 83 opposite strand, wdr83os.L, WDR83OS, wdr83os
    Background
    The function of C19orf56 protein has not been widely studied, and is yet to be fully elucidated.
    Molecular Weight
    12 kDa (MW of target protein)
You are here:
help Support