Chromosome 19 Open Reading Frame 56 (C19orf56) (N-Term) antibody

Details for Product No. ABIN635449
Antigen
Epitope
N-Term
2
Reactivity
Human, Mouse (Murine), Rat (Rattus)
2
2
2
2
2
2
2
2
1
1
1
1
Host
Rabbit
2
Clonality
Polyclonal
Application
Western Blotting (WB)
2
Options
Immunogen C19 ORF56 antibody was raised using the N terminal Of C19 rf56 corresponding to a region with amino acids STNNMSDPRRPNKVLRYKPPPSECNPALDDPTPDYMNLLGMIFSMCGLML
Specificity C19 ORF56 antibody was raised against the N terminal Of C19 rf56
Purification Affinity purified
Antigen
Alternative Name C19ORF56
Background The function of C19orf56 protein has not been widely studied, and is yet to be fully elucidated.
Molecular Weight 12 kDa (MW of target protein)
Application Notes WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Comment

C19ORF56 Blocking Peptide, catalog no. 33R-8878, is also available for use as a blocking control in assays to test for specificity of this C19ORF56 antibody

Restrictions For Research Use only
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF56 antibody in PBS
Concentration Lot specific
Buffer PBS
Handling Advice Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Storage 4 °C
Storage Comment Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Supplier Images
Image no. 1 for anti-Chromosome 19 Open Reading Frame 56 (C19orf56) (N-Term) antibody (ABIN635449) C19ORF56 antibody used at 1 ug/ml to detect target protein.