TMEM69 antibody (Middle Region)

Catalog No. ABIN635451

Product Details anti-TMEM69 Antibody

Target: TMEM69 (Transmembrane Protein 69 (TMEM69))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TMEM69 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: TMEM69 antibody was raised against the middle region of TMEM69

Purification: Affinity purified

Immunogen: TMEM69 antibody was raised using the middle region of TMEM69 corresponding to a region with amino acids AYGASFLSFLGGIRWGFALPEGSPAKPDYLNLASSAAPLFFSWFAFLISE

Application Details

Application Notes: WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TMEM69 Blocking Peptide, catalog no. 33R-1628, is also available for use as a blocking control in assays to test for specificity of this TMEM69 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM69 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TMEM69

Target: TMEM69 (Transmembrane Protein 69 (TMEM69))

Alternative Name: TMEM69 (TMEM69 Products)

Synonyms: zgc:194288 antibody, zgc:194295 antibody, C1orf154 antibody, RP11-767N6.4 antibody, A630048M13Rik antibody, Transmembrane protein 69 antibody, transmembrane protein 69 antibody, tmm69 antibody, TMEM69 antibody, tmem69 antibody, Tmem69 antibody

Background: The function of TMEM69 protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 27 kDa (MW of target protein)