TMEM69 antibody (Transmembrane Protein 69) (Middle Region)

Details for Product anti-TMEM69 Antibody No. ABIN635451
Antigen
Epitope
Middle Region
1
1
Reactivity
Human
4
2
2
2
1
1
1
1
1
Host
Rabbit
4
Clonality
Polyclonal
Application
Immunohistochemistry (IHC), Western Blotting (WB)
4
3
2
1
Options
Immunogen TMEM69 antibody was raised using the middle region of TMEM69 corresponding to a region with amino acids AYGASFLSFLGGIRWGFALPEGSPAKPDYLNLASSAAPLFFSWFAFLISE
Specificity TMEM69 antibody was raised against the middle region of TMEM69
Purification Affinity purified
Antigen
Alternative Name TMEM69
Background The function of TMEM69 protein is not widely studied, and is yet to be elucidated fully.
Molecular Weight 27 kDa (MW of target protein)
Application Notes WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.
Comment

TMEM69 Blocking Peptide, catalog no. 33R-1628, is also available for use as a blocking control in assays to test for specificity of this TMEM69 antibody

Restrictions For Research Use only
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM69 antibody in PBS
Concentration Lot specific
Buffer PBS
Handling Advice Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Storage 4 °C
Storage Comment Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Supplier Images
Image no. 1 for anti-Transmembrane Protein 69 (TMEM69) (Middle Region) antibody (ABIN635451) TMEM69 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to ...
Image no. 2 for anti-Transmembrane Protein 69 (TMEM69) (Middle Region) antibody (ABIN635451) TMEM69 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Ma...
Image no. 3 for anti-Transmembrane Protein 69 (TMEM69) (Middle Region) antibody (ABIN635451) TMEM69 antibody used at 0.5 ug/ml to detect target protein.