TMEM69 antibody (Middle Region)
-
- Target See all TMEM69 products
- TMEM69 (Transmembrane Protein 69 (TMEM69))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This TMEM69 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificity
- TMEM69 antibody was raised against the middle region of TMEM69
- Purification
- Affinity purified
- Immunogen
- TMEM69 antibody was raised using the middle region of TMEM69 corresponding to a region with amino acids AYGASFLSFLGGIRWGFALPEGSPAKPDYLNLASSAAPLFFSWFAFLISE
-
-
- Application Notes
-
WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
TMEM69 Blocking Peptide, catalog no. 33R-1628, is also available for use as a blocking control in assays to test for specificity of this TMEM69 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM69 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TMEM69 (Transmembrane Protein 69 (TMEM69))
- Alternative Name
- TMEM69 (TMEM69 Products)
- Synonyms
- zgc:194288 antibody, zgc:194295 antibody, C1orf154 antibody, RP11-767N6.4 antibody, A630048M13Rik antibody, Transmembrane protein 69 antibody, transmembrane protein 69 antibody, tmm69 antibody, TMEM69 antibody, tmem69 antibody, Tmem69 antibody
- Background
- The function of TMEM69 protein is not widely studied, and is yet to be elucidated fully.
- Molecular Weight
- 27 kDa (MW of target protein)
-