TMEM161A antibody (Middle Region)

Catalog No. ABIN635452

This Rabbit Polyclonal antibody specifically detects TMEM161A in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for TMEM161A antibody (Middle Region) (ABIN635452)

Target: TMEM161A (Transmembrane Protein 161A (TMEM161A))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TMEM161A antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-TMEM161A Antibody

Binding Specificity: Middle Region

Specificity: TMEM161 A antibody was raised against the middle region of TMEM161

Purification: Affinity purified

Immunogen: TMEM161 A antibody was raised using the middle region of TMEM161 corresponding to a region with amino acids LLAMLVQVVREETLELGLEPGLASMTQNLEPLLKKQGWDWALPVAKLAIR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TMEM161A Blocking Peptide, (ABIN940503), is also available for use as a blocking control in assays to test for specificity of this TMEM161A antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM160 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TMEM161A

Target: TMEM161A (Transmembrane Protein 161A (TMEM161A))

Alternative Name: TMEM161A

Background: TMEM161A may be involved in the development of dendritic cells.

Molecular Weight: 53 kDa (MW of target protein)

Pathways: Positive Regulation of Response to DNA Damage Stimulus