TMEM127 antibody (Middle Region)

Catalog No. ABIN635454

This anti-TMEM127 antibody is a Rabbit Polyclonal antibody detecting TMEM127 in WB. Suitable for Human, Mouse and Rat.

Quick Overview for TMEM127 antibody (Middle Region) (ABIN635454)

Target: TMEM127 (Transmembrane Protein 127 (TMEM127))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TMEM127 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-TMEM127 Antibody

Binding Specificity: Middle Region

Specificity: TMEM127 antibody was raised against the middle region of TMEM127

Purification: Affinity purified

Immunogen: TMEM127 antibody was raised using the middle region of TMEM127 corresponding to a region with amino acids AFLLDVFGPKHPALKITRRYAFAHILTVLQCATVIGFSYWASELILAQQQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TMEM127 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this TMEM127 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM127 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TMEM127

Target: TMEM127 (Transmembrane Protein 127 (TMEM127))

Alternative Name: TMEM127

Background: TMEM127 is a multi-pass membrane protein. The exact function of TMEM127 remains unknown.

Molecular Weight: 26 kDa (MW of target protein)