SUSD4 antibody (Middle Region)

Catalog No. ABIN635458

This Rabbit Polyclonal antibody specifically detects SUSD4 in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for SUSD4 antibody (Middle Region) (ABIN635458)

Target: SUSD4 (Sushi Domain Containing 4 (SUSD4))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SUSD4 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-SUSD4 Antibody

Binding Specificity: Middle Region

Specificity: SUSD4 antibody was raised against the middle region of SUSD4

Purification: Affinity purified

Immunogen: SUSD4 antibody was raised using the middle region of SUSD4 corresponding to a region with amino acids HGDFVCHPRPCERYNHGTVVEFYCDPGYSLTSDYKYITCQYGEWFPSYQV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SUSD4 Blocking Peptide, (ABIN939120), is also available for use as a blocking control in assays to test for specificity of this SUSD4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SUSD4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SUSD4

Target: SUSD4 (Sushi Domain Containing 4 (SUSD4))

Alternative Name: SUSD4

Background: SUSD4 contains 4 Sushi (CCP/SCR) domains. It is a single-pass type I membrane protein. The function of the SUSD4 protein remains unknown.

Molecular Weight: 54 kDa (MW of target protein)