LRRC59 antibody (C-Term)

Catalog No. ABIN635464

This Rabbit Polyclonal antibody specifically detects LRRC59 in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for LRRC59 antibody (C-Term) (ABIN635464)

Target: LRRC59 (Leucine Rich Repeat Containing 59 (LRRC59))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LRRC59 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-LRRC59 Antibody

Binding Specificity: C-Term

Specificity: LRRC59 antibody was raised against the C terminal of LRRC59

Purification: Affinity purified

Immunogen: LRRC59 antibody was raised using the C terminal of LRRC59 corresponding to a region with amino acids KEYDALKAAKREQEKKPKKEANQAPKSKSGSRPRKPPPRKHTRSWAVLKL

Application Details

Application Notes: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

LRRC59 Blocking Peptide, (ABIN939751), is also available for use as a blocking control in assays to test for specificity of this LRRC59 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LRRC59 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for LRRC59

Target: LRRC59 (Leucine Rich Repeat Containing 59 (LRRC59))

Alternative Name: LRRC59

Background: The function of LRRC59 protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 35 kDa (MW of target protein)