TMEM63C antibody (Middle Region)

Catalog No. ABIN635467

This Rabbit Polyclonal antibody specifically detects TMEM63C in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for TMEM63C antibody (Middle Region) (ABIN635467)

Target: TMEM63C (Transmembrane Protein 63C (TMEM63C))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TMEM63C antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-TMEM63C Antibody

Binding Specificity: Middle Region

Specificity: TMEM63 C antibody was raised against the middle region of TMEM63

Purification: Affinity purified

Immunogen: TMEM63 C antibody was raised using the middle region of TMEM63 corresponding to a region with amino acids EEEIQTVFDMEPSSTSSTPTSLLYVATVLQEPELNLTPASSPARHTYGTM

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TMEM63C Blocking Peptide, (ABIN937734), is also available for use as a blocking control in assays to test for specificity of this TMEM63C antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM60 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TMEM63C

Target: TMEM63C (Transmembrane Protein 63C (TMEM63C))

Alternative Name: TMEM63C

Background: The function of TMEM63C protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 93 kDa (MW of target protein)