GALNTL1 antibody (N-Term)

Catalog No. ABIN635472

This anti-GALNTL1 antibody is a Rabbit Polyclonal antibody detecting GALNTL1 in WB. Suitable for Human and Rat.

Quick Overview for GALNTL1 antibody (N-Term) (ABIN635472)

Target: GALNTL1 (UDP-N-Acetyl-alpha-D-Galactosamine:polypeptide N-Acetylgalactosaminyltransferase-Like 1 (GALNTL1))

Reactivity: Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GALNTL1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-GALNTL1 Antibody

Binding Specificity: N-Term

Specificity: GALNTL1 antibody was raised against the N terminal Of Galntl1

Purification: Affinity purified

Immunogen: GALNTL1 antibody was raised using the N terminal Of Galntl1 corresponding to a region with amino acids LSAKQLKAGEDPYRQHAFNQLESDKLSPDRPIRDTRHYSCPSVSYSSDLP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GALNTL1 Blocking Peptide, (ABIN5613720), is also available for use as a blocking control in assays to test for specificity of this GALNTL1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GALNTL1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GALNTL1

Target: GALNTL1 (UDP-N-Acetyl-alpha-D-Galactosamine:polypeptide N-Acetylgalactosaminyltransferase-Like 1 (GALNTL1))

Alternative Name: GALNTL1

Background: GALNTL1 belongs to the glycosyltransferase 2 family, GalNAc-T subfamily. It contains 1 ricin B-type lectin domain. GALNTL1 may catalyze the initial reaction in O-linked oligosaccharide biosynthesis, the transfer of an N-acetyl-D-galactosamine residue to a serine or threonine residue on the protein receptor.

Molecular Weight: 63 kDa (MW of target protein)