BAT5 antibody (N-Term)

Catalog No. ABIN635476

This Rabbit Polyclonal antibody specifically detects BAT5 in WB. It exhibits reactivity toward Human and Mouse.

Quick Overview for BAT5 antibody (N-Term) (ABIN635476)

Target: BAT5 (ABHD16A) (Abhydrolase Domain Containing 16A (ABHD16A))

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This BAT5 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-BAT5 Antibody

Binding Specificity: N-Term

Specificity: BAT5 antibody was raised against the N terminal of BAT5

Purification: Affinity purified

Immunogen: BAT5 antibody was raised using the N terminal of BAT5 corresponding to a region with amino acids VTAPHSSSWDTYYQPRALEKHADSILALASVFWSISYYSSPFAFFYLYRK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

BAT5 Blocking Peptide, catalog no. 33R-9837, is also available for use as a blocking control in assays to test for specificity of this BAT5 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BAT5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for BAT5

Target: BAT5 (ABHD16A) (Abhydrolase Domain Containing 16A (ABHD16A))

Alternative Name: BAT5

Background: A cluster of genes, BAT1-BAT5, has been localized in the vicinity of the genes for TNF alpha and TNF beta. These genes are all within the human major histocompatibility complex class III region. BAT5 is thought to be involved in some aspects of immunity.

Molecular Weight: 63 kDa (MW of target protein)