LRRC37B antibody (N-Term)

Catalog No. ABIN635493

This anti-LRRC37B antibody is a Rabbit Polyclonal antibody detecting LRRC37B in WB. Suitable for Human.

Quick Overview for LRRC37B antibody (N-Term) (ABIN635493)

Target: LRRC37B (Leucine Rich Repeat Containing 37B (LRRC37B))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LRRC37B antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-LRRC37B Antibody

Binding Specificity: N-Term

Specificity: LRRC37 B antibody was raised against the N terminal of LRRC37

Purification: Affinity purified

Immunogen: LRRC37 B antibody was raised using the N terminal of LRRC37 corresponding to a region with amino acids VSRPTKFVVSPKNLKKDLAERWSLPEIVGIPHQLSKPQRQKQTLPDDYLS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

LRRC37B Blocking Peptide, (ABIN5614575), is also available for use as a blocking control in assays to test for specificity of this LRRC37B antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LRRC30 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for LRRC37B

Target: LRRC37B (Leucine Rich Repeat Containing 37B (LRRC37B))

Alternative Name: LRRC37B

Background: The function of LRRC37B protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 105 kDa (MW of target protein)