ELFN2 antibody (N-Term)

Catalog No. ABIN635494

This Rabbit Polyclonal antibody specifically detects ELFN2 in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for ELFN2 antibody (N-Term) (ABIN635494)

Target: ELFN2 (Extracellular Leucine-Rich Repeat and Fibronectin Type III Domain Containing 2 (ELFN2))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ELFN2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-ELFN2 Antibody

Binding Specificity: N-Term

Specificity: ELFN2 antibody was raised against the N terminal of ELFN2

Purification: Affinity purified

Immunogen: ELFN2 antibody was raised using the N terminal of ELFN2 corresponding to a region with amino acids PVSHPTPYSTDAQREPDENSGFNPDEILSVEPPASSTTDASAGPAIKLHH

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ELFN2 Blocking Peptide, (ABIN5613358), is also available for use as a blocking control in assays to test for specificity of this ELFN2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ELFN2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ELFN2

Target: ELFN2 (Extracellular Leucine-Rich Repeat and Fibronectin Type III Domain Containing 2 (ELFN2))

Alternative Name: ELFN2

Background: ELFN2 is a single-pass membrane protein. It contains 1 fibronectin type-III domain and 5 LRR (leucine-rich) repeats. The exact function of ELFN2 remains unknown.

Molecular Weight: 90 kDa (MW of target protein)