PIGW antibody (Middle Region)

Catalog No. ABIN635512

Product Details anti-PIGW Antibody

Target: PIGW (Phosphatidylinositol Glycan W (PIGW))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PIGW antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PIGW antibody was raised against the middle region of PIGW

Purification: Affinity purified

Immunogen: PIGW antibody was raised using the middle region of PIGW corresponding to a region with amino acids IALGITVLYQLALDFTSLKRLILYGTDGSGTRVGLLNANREGIISTLGYV

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PIGW Blocking Peptide, catalog no. 33R-3893, is also available for use as a blocking control in assays to test for specificity of this PIGW antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PIGW antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PIGW

Target: PIGW (Phosphatidylinositol Glycan W (PIGW))

Alternative Name: PIGW (PIGW Products)

Synonyms: Gwt1 antibody, PIG-W antibody, 2610044A17Rik antibody, phosphatidylinositol glycan anchor biosynthesis class W antibody, phosphatidylinositol glycan anchor biosynthesis, class W antibody, PIGW antibody, Pigw antibody

Background: Glycosylphosphatidylinositol (GPI) is a complex glycolipid that anchors many proteins to the cell surface. PIGW acts in the third step of GPI biosynthesis and acylates the inositol ring of phosphatidylinositol.

Molecular Weight: 57 kDa (MW of target protein)

Pathways: Inositol Metabolic Process