WDR33 antibody (N-Term)

Catalog No. ABIN635525

The Rabbit Polyclonal anti-WDR33 antibody has been validated for WB. It is suitable to detect WDR33 in samples from Human.

Quick Overview for WDR33 antibody (N-Term) (ABIN635525)

Target: WDR33 (WD Repeat Domain 33 (WDR33))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This WDR33 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-WDR33 Antibody

Binding Specificity: N-Term

Specificity: WDR33 antibody was raised against the N terminal of WDR33

Purification: Affinity purified

Immunogen: WDR33 antibody was raised using the N terminal of WDR33 corresponding to a region with amino acids IWQRDQRDMRAIQPDAGYYNDLVPPIGMLNNPMNAVTTKFVRTSTNKVKC

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

WDR33 Blocking Peptide, (ABIN939600), is also available for use as a blocking control in assays to test for specificity of this WDR33 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WDR33 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for WDR33

Target: WDR33 (WD Repeat Domain 33 (WDR33))

Alternative Name: WDR33

Background: WDR33 is a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation.

Molecular Weight: 38 kDa (MW of target protein)