Reticulon 1 antibody (N-Term)
-
- Target See all Reticulon 1 (RTN1) Antibodies
- Reticulon 1 (RTN1)
-
Binding Specificity
- N-Term
-
Reactivity
- Mouse, Human, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Reticulon 1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- RTN1 antibody was raised against the N terminal of RTN1
- Purification
- Affinity purified
- Immunogen
- RTN1 antibody was raised using the N terminal of RTN1 corresponding to a region with amino acids EEREAELDSELIIESCDASSASEESPKREQDSPPMKPSALDAIREETGVR
- Top Product
- Discover our top product RTN1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
RTN1 Blocking Peptide, catalog no. 33R-2384, is also available for use as a blocking control in assays to test for specificity of this RTN1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RTN1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Reticulon 1 (RTN1)
- Alternative Name
- RTN1 (RTN1 Products)
- Background
- Reticulons are associated with the endoplasmic reticulum, and are involved in neuroendocrine secretion or in membrane trafficking in neuroendocrine cells.
- Molecular Weight
- 39 kDa (MW of target protein)
-