AWAT2 antibody (C-Term)

Catalog No. ABIN635543

The Rabbit Polyclonal anti-AWAT2 antibody has been validated for WB. It is suitable to detect AWAT2 in samples from Human, Mouse and Rat.

Quick Overview for AWAT2 antibody (C-Term) (ABIN635543)

Target: AWAT2 (Acyl-CoA Wax Alcohol Acyltransferase 2 (AWAT2))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This AWAT2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-AWAT2 Antibody

Binding Specificity: C-Term

Specificity: DGAT2 L4 antibody was raised against the C terminal of DGAT2 4

Purification: Affinity purified

Immunogen: DGAT2 L4 antibody was raised using the C terminal of DGAT2 4 corresponding to a region with amino acids GEPLPMPKIENPSQEIVAKYHTLYIDALRKLFDQHKTKFGISETQELEII

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DGAT2L4 Blocking Peptide, (ABIN938628), is also available for use as a blocking control in assays to test for specificity of this DGAT2L4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DGAT0 4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for AWAT2

Target: AWAT2 (Acyl-CoA Wax Alcohol Acyltransferase 2 (AWAT2))

Alternative Name: DGAT2L4

Background: DGAT2L4 is acyltransferase that predominantly esterify long chain (wax) alcohols with acyl-CoA-derived fatty acids to produce wax esters. Wax esters are enriched in sebum, suggesting that it plays a central role in lipid metabolism in skin. It has no activity using decyl alcohol and significantly prefers the C16 and C18 alcohols.

Molecular Weight: 38 kDa (MW of target protein)