PEX10 antibody (C-Term)

Catalog No. ABIN635547

This anti-PEX10 antibody is a Rabbit Polyclonal antibody detecting PEX10 in WB. Suitable for Human.

Quick Overview for PEX10 antibody (C-Term) (ABIN635547)

Target: PEX10 (Peroxisomal Biogenesis Factor 10 (PEX10))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PEX10 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-PEX10 Antibody

Binding Specificity: C-Term

Specificity: PEX10 antibody was raised against the C terminal of PEX10

Purification: Affinity purified

Immunogen: PEX10 antibody was raised using the C terminal of PEX10 corresponding to a region with amino acids ERRHPTATPCGHLFCWECITAWCSSKAECPLCREKFPPQKLIYLRHYR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PEX10 Blocking Peptide, (ABIN938098), is also available for use as a blocking control in assays to test for specificity of this PEX10 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PEX10 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PEX10

Target: PEX10 (Peroxisomal Biogenesis Factor 10 (PEX10))

Alternative Name: PEX10

Background: PEX10 is a protein involved in import of peroxisomal matrix proteins. This protein localizes to the peroxisomal membrane. Mutations in PEX10 gene result in phenotypes within the Zellweger spectrum of peroxisomal biogenesis disorders, ranging from neonatal adrenoleukodystrophy to Zellweger syndrome.

Molecular Weight: 37 kDa (MW of target protein)

Pathways: Monocarboxylic Acid Catabolic Process