UBE2D2 antibody

Catalog No. ABIN635549

The Rabbit Polyclonal anti-UBE2D2 antibody has been validated for WB. It is suitable to detect UBE2D2 in samples from Human, Mouse, Rat, Drosophila melanogaster and C. elegans.

Quick Overview for UBE2D2 antibody (ABIN635549)

Target: UBE2D2 (Ubiquitin-Conjugating Enzyme E2D 2 (UBE2D2))

Reactivity: Human, Mouse, Rat, Drosophila melanogaster, C. elegans

Host: Rabbit

Clonality: Polyclonal

Conjugate: This UBE2D2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-UBE2D2 Antibody

Purification: Affinity purified

Immunogen: UBE2 D2 antibody was raised using a synthetic peptide corresponding to a region with amino acids TIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSIC

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

UBE2D2 Blocking Peptide, (ABIN5616862), is also available for use as a blocking control in assays to test for specificity of this UBE2D2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UBE0 2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for UBE2D2

Target: UBE2D2 (Ubiquitin-Conjugating Enzyme E2D 2 (UBE2D2))

Alternative Name: UBE2D2

Background: The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. UBE2D2 is a member of the E2 ubiquitin-conjugating enzyme family. This enzyme functions in the ubiquitination of the tumor-suppressor protein p53, which is induced by an E3 ubiquitin-protein ligase.

Molecular Weight: 17 kDa (MW of target protein)

Pathways: Activation of Innate immune Response, Toll-Like Receptors Cascades