CRTAP antibody (N-Term)

Catalog No. ABIN635556

This anti-CRTAP antibody is a Rabbit Polyclonal antibody detecting CRTAP in WB. Suitable for Human.

Quick Overview for CRTAP antibody (N-Term) (ABIN635556)

Target: CRTAP (Cartilage Associated Protein (CRTAP))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CRTAP antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-CRTAP Antibody

Binding Specificity: N-Term

Specificity: CRTAP antibody was raised against the N terminal of CRTAP

Purification: Affinity purified

Immunogen: CRTAP antibody was raised using the N terminal of CRTAP corresponding to a region with amino acids RLFGGLLRRAHCLKRCKQGLPAFRQSQPSREVLADFQRREPYKFLQFAYF

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CRTAP Blocking Peptide, (ABIN5613008), is also available for use as a blocking control in assays to test for specificity of this CRTAP antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CRTAP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CRTAP

Target: CRTAP (Cartilage Associated Protein (CRTAP))

Alternative Name: CRTAP

Background: The protein encoded by this gene is similar to the chicken and mouse CRTAP genes. The encoded protein is a scaffolding protein that may influence the activity of at least one member of the cytohesin/ARNO family in response to specific cellular stimuli.

Molecular Weight: 44 kDa (MW of target protein)