CRTAP antibody (N-Term)
-
- Target See all CRTAP Antibodies
- CRTAP (Cartilage Associated Protein (CRTAP))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CRTAP antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- CRTAP antibody was raised against the N terminal of CRTAP
- Purification
- Affinity purified
- Immunogen
- CRTAP antibody was raised using the N terminal of CRTAP corresponding to a region with amino acids RLFGGLLRRAHCLKRCKQGLPAFRQSQPSREVLADFQRREPYKFLQFAYF
- Top Product
- Discover our top product CRTAP Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
CRTAP Blocking Peptide, catalog no. 33R-8020, is also available for use as a blocking control in assays to test for specificity of this CRTAP antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CRTAP antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CRTAP (Cartilage Associated Protein (CRTAP))
- Alternative Name
- CRTAP (CRTAP Products)
- Background
- The protein encoded by this gene is similar to the chicken and mouse CRTAP genes. The encoded protein is a scaffolding protein that may influence the activity of at least one member of the cytohesin/ARNO family in response to specific cellular stimuli.
- Molecular Weight
- 44 kDa (MW of target protein)
-