PTPN2 antibody (Middle Region)
-
- Target See all PTPN2 Antibodies
- PTPN2 (Protein tyrosine Phosphatase, Non-Receptor Type 2 (PTPN2))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PTPN2 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificity
- PTPN2 antibody was raised against the middle region of PTPN2
- Purification
- Affinity purified
- Immunogen
- PTPN2 antibody was raised using the middle region of PTPN2 corresponding to a region with amino acids ESGSLNPDHGPAVIHCSAGIGRSGTFSLVDTCLVLMEKGDDINIKQVLLN
- Top Product
- Discover our top product PTPN2 Primary Antibody
-
-
- Application Notes
-
WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PTPN2 Blocking Peptide, catalog no. 33R-2730, is also available for use as a blocking control in assays to test for specificity of this PTPN2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PTPN2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PTPN2 (Protein tyrosine Phosphatase, Non-Receptor Type 2 (PTPN2))
- Alternative Name
- PTPN2 (PTPN2 Products)
- Background
- PTPN2 is a member of the protein tyrosine phosphatase (PTP) family. Members of the PTP family share a highly conserved catalytic motif, which is essential for the catalytic activity. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. Epidermal growth factor receptor and the adaptor protein Shc were reported to be substrates of this PTP, which suggested the roles in growth factor mediated cell signaling.
- Molecular Weight
- 25 kDa (MW of target protein)
- Pathways
- EGFR Signaling Pathway, Carbohydrate Homeostasis, Regulation of Carbohydrate Metabolic Process, Platelet-derived growth Factor Receptor Signaling
-