PLP1 antibody

Catalog No. ABIN635572

This Rabbit Polyclonal antibody specifically detects PLP1 in WB. It exhibits reactivity toward Human, Rat, Mouse and Dog.

Quick Overview for PLP1 antibody (ABIN635572)

Target: PLP1 (Proteolipid Protein 1 (PLP1))

Reactivity: Human, Rat, Mouse, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PLP1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-PLP1 Antibody

Purification: Affinity purified

Immunogen: PLP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GHEALTGTEKLIETYFSKNYQDYEYLINVIHAFQYVIYGTASFFFLYGAL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PLP1 Blocking Peptide, (ABIN938693), is also available for use as a blocking control in assays to test for specificity of this PLP1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PLP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PLP1

Target: PLP1 (Proteolipid Protein 1 (PLP1))

Alternative Name: PLP1

Background: PLP1 is a transmembrane proteolipid protein that is the predominant myelin protein present in the central nervous system. It may play a role in the compaction, stabilization, and maintenance of myelin sheaths, as well as in oligodendrocyte development and axonal survival. Mutations in this gene cause X-linked Pelizaeus-Merzbacher disease and spastic paraplegia type 2. Alternatively spliced transcript variants encoding distinct isoforms or having different 5' UTRs, have been identified for this gene.

Molecular Weight: 30 kDa (MW of target protein)