C17orf78 antibody (Middle Region)

Catalog No. ABIN635579

The Rabbit Polyclonal anti-C17orf78 antibody has been validated for WB. It is suitable to detect C17orf78 in samples from Human.

Quick Overview for C17orf78 antibody (Middle Region) (ABIN635579)

Target: C17orf78 (Chromosome 17 Open Reading Frame78 (C17orf78))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This C17orf78 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-C17orf78 Antibody

Binding Specificity: Middle Region

Specificity: C17 ORF78 antibody was raised against the middle region of C17 rf78

Purification: Affinity purified

Immunogen: C17 ORF78 antibody was raised using the middle region of C17 rf78 corresponding to a region with amino acids LGARKLCQCQWLWRWQKKGGQPPGTAESKPDSQPQKVGQDAANSSNPKKA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C17ORF78 Blocking Peptide, (ABIN940349), is also available for use as a blocking control in assays to test for specificity of this C17ORF78 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF78 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for C17orf78

Target: C17orf78 (Chromosome 17 Open Reading Frame78 (C17orf78))

Alternative Name: C17ORF78

Background: The exact function of the protein encoded by this gene is not known.

Molecular Weight: 30 kDa (MW of target protein)