SLC6A8 antibody

Catalog No. ABIN635581

This Rabbit Polyclonal antibody specifically detects SLC6A8 in WB. It exhibits reactivity toward Human.

Quick Overview for SLC6A8 antibody (ABIN635581)

Target: SLC6A8 (Solute Carrier Family 6 (Neurotransmitter Transporter, Creatine), Member 8 (SLC6A8))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLC6A8 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-SLC6A8 Antibody

Purification: Affinity purified

Immunogen: SLC6 A8 antibody was raised using a synthetic peptide corresponding to a region with amino acids VFSILGFMAAEQGVHISKVAESGPGLAFIAYPRAVTLMPVAPLWAALFFF

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLC6A8 Blocking Peptide, (ABIN5616274), is also available for use as a blocking control in assays to test for specificity of this SLC6A8 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC0 8 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SLC6A8

Target: SLC6A8 (Solute Carrier Family 6 (Neurotransmitter Transporter, Creatine), Member 8 (SLC6A8))

Alternative Name: SLC6A8

Background: SLC6A8 is required for the uptake of creatine in muscles and brain.

Molecular Weight: 70 kDa (MW of target protein)

Pathways: Retinoic Acid Receptor Signaling Pathway, Intracellular Steroid Hormone Receptor Signaling Pathway, Regulation of Intracellular Steroid Hormone Receptor Signaling, Nuclear Hormone Receptor Binding, ER-Nucleus Signaling, Unfolded Protein Response