SLC6A8 antibody
-
- Target See all SLC6A8 Antibodies
- SLC6A8 (Solute Carrier Family 6 (Neurotransmitter Transporter, Creatine), Member 8 (SLC6A8))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SLC6A8 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- SLC6 A8 antibody was raised using a synthetic peptide corresponding to a region with amino acids VFSILGFMAAEQGVHISKVAESGPGLAFIAYPRAVTLMPVAPLWAALFFF
- Top Product
- Discover our top product SLC6A8 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SLC6A8 Blocking Peptide, catalog no. 33R-9541, is also available for use as a blocking control in assays to test for specificity of this SLC6A8 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC0 8 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLC6A8 (Solute Carrier Family 6 (Neurotransmitter Transporter, Creatine), Member 8 (SLC6A8))
- Alternative Name
- SLC6A8 (SLC6A8 Products)
- Background
- SLC6A8 is required for the uptake of creatine in muscles and brain.
- Molecular Weight
- 70 kDa (MW of target protein)
- Pathways
- Retinoic Acid Receptor Signaling Pathway, Intracellular Steroid Hormone Receptor Signaling Pathway, Regulation of Intracellular Steroid Hormone Receptor Signaling, Nuclear Hormone Receptor Binding, ER-Nucleus Signaling, Unfolded Protein Response
-