Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

JAM3 antibody (N-Term)

JAM3 Reactivity: Human, Mouse WB Host: Rabbit Polyclonal unconjugated
Catalog No. ABIN635598
$836.98
Plus shipping costs $45.00
100 μL
Shipping to: United States
Delivery in 9 to 11 Business Days
  • Target See all JAM3 Antibodies
    JAM3 (Junctional Adhesion Molecule 3 (JAM3))
    Binding Specificity
    • 15
    • 7
    • 6
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    N-Term
    Reactivity
    • 55
    • 40
    • 26
    • 7
    • 6
    • 5
    • 3
    • 2
    • 2
    • 1
    Human, Mouse
    Host
    • 38
    • 12
    • 7
    • 3
    Rabbit
    Clonality
    • 45
    • 15
    Polyclonal
    Conjugate
    • 28
    • 5
    • 5
    • 3
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    This JAM3 antibody is un-conjugated
    Application
    • 19
    • 19
    • 16
    • 13
    • 13
    • 12
    • 12
    • 10
    • 5
    • 5
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    Western Blotting (WB)
    Specificity
    JAM3 antibody was raised against the N terminal of JAM3
    Purification
    Affinity purified
    Immunogen
    JAM3 antibody was raised using the N terminal of JAM3 corresponding to a region with amino acids SSNRTPVVQEFESVELSCIITDSQTSDPRIEWKKIQDEQTTYVFFDNKIQ
  • Application Notes
    WB: 1 µg/mL
    Optimal conditions should be determined by the investigator.
    Comment

    JAM3 Blocking Peptide, catalog no. 33R-8834, is also available for use as a blocking control in assays to test for specificity of this JAM3 antibody

    Restrictions
    For Research Use only
  • Format
    Lyophilized
    Reconstitution
    Lyophilized powder. Add distilled water for a 1 mg/mL concentration of JAM3 antibody in PBS
    Concentration
    Lot specific
    Buffer
    PBS
    Handling Advice
    Avoid repeated freeze/thaw cycles.
    Dilute only prior to immediate use.
    Storage
    4 °C/-20 °C
    Storage Comment
    Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
  • Target
    JAM3 (Junctional Adhesion Molecule 3 (JAM3))
    Alternative Name
    JAM3 (JAM3 Products)
    Synonyms
    JAM3 antibody, jam3 antibody, sr:nyz155 antibody, wu:fb30h11 antibody, wu:fc08c06 antibody, wu:fc13e04 antibody, wu:fc25g11 antibody, jamc.2 antibody, 1110002N23Rik antibody, JAM-3 antibody, JAM-C antibody, Jcam3 antibody, JAM-2 antibody, JAMC antibody, junctional adhesion molecule 3 antibody, junctional adhesion molecule 3b antibody, junctional adhesion molecule 3a antibody, junction adhesion molecule 3 antibody, JAM3 antibody, jam3b antibody, jam3a antibody, Jam3 antibody
    Background
    Tight junctions represent one mode of cell-to-cell adhesion in epithelial or endothelial cell sheets, forming continuous seals around cells and serving as a physical barrier to prevent solutes and water from passing freely through the paracellular space. JAM3, one member of the immunoglobulin superfamily, is localized in the tight junctions between high endothelial cells. Unlike other proteins in this family, this protein is unable to adhere to leukocyte cell lines and only forms weak homotypic interactions. JAM3 is a member of the junctional adhesion molecule protein family and acts as a receptor for another member of this family.
    Molecular Weight
    28 kDa (MW of target protein)
You are here:
Support