TMEM117 antibody (Middle Region)

Catalog No. ABIN635605

This Rabbit Polyclonal antibody specifically detects TMEM117 in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for TMEM117 antibody (Middle Region) (ABIN635605)

Target: TMEM117 (Transmembrane Protein 117 (TMEM117))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TMEM117 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-TMEM117 Antibody

Binding Specificity: Middle Region

Specificity: TMEM117 antibody was raised against the middle region of TMEM117

Purification: Affinity purified

Immunogen: TMEM117 antibody was raised using the middle region of TMEM117 corresponding to a region with amino acids GQYIGPGQKIYTVKDSESLKDLNRTKLSWEWRSNHTNPRTNKTYVEGDMF

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TMEM117 Blocking Peptide, (ABIN938906), is also available for use as a blocking control in assays to test for specificity of this TMEM117 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM117 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TMEM117

Target: TMEM117 (Transmembrane Protein 117 (TMEM117))

Alternative Name: TMEM117

Background: TMEM117 is a multi-pass membrane protein. It belongs to the TMEM117 family. The exact function of TMEM117 remains unknown.

Molecular Weight: 45 kDa (MW of target protein)