SERINC2 antibody (N-Term)

Catalog No. ABIN635607

This anti-SERINC2 antibody is a Rabbit Polyclonal antibody detecting SERINC2 in WB. Suitable for Human.

Quick Overview for SERINC2 antibody (N-Term) (ABIN635607)

Target: SERINC2 (serine Incorporator 2 (SERINC2))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SERINC2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-SERINC2 Antibody

Binding Specificity: N-Term

Specificity: SERINC2 antibody was raised against the N terminal of SERINC2

Purification: Affinity purified

Immunogen: SERINC2 antibody was raised using the N terminal of SERINC2 corresponding to a region with amino acids VCEEGAGIPTVLQGHIDCGSLLGYRAVYRMCFATAAFFFFFTLLMLCVSS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SERINC2 Blocking Peptide, (ABIN5616057), is also available for use as a blocking control in assays to test for specificity of this SERINC2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SERINC2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SERINC2

Target: SERINC2 (serine Incorporator 2 (SERINC2))

Alternative Name: SERINC2

Background: The function of SERINC2 protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 51 kDa (MW of target protein)