FLJ20489 (C-Term) antibody

Catalog No. ABIN635609

The Rabbit Polyclonal anti- antibody has been validated for IHC and WB. It is suitable to detect in samples from Human.

Quick Overview for FLJ20489 (C-Term) antibody (ABIN635609)

Target: FLJ20489

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: Un-conjugated

Application: Immunohistochemistry (IHC), Western Blotting (WB)

Product Details

Binding Specificity: C-Term

Specificity: FLJ20489 antibody was raised against the C terminal of FLJ20489

Purification: Affinity purified

Immunogen: FLJ20489 antibody was raised using the C terminal of FLJ20489 corresponding to a region with amino acids LISGDSPASAFQSAGIIGVSHRARPGSVFLARSEESLYLRPGQQSQEVKV

Application Details

Application Notes: WB: 0.0625 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FLJ20489 Blocking Peptide, (ABIN940449), is also available for use as a blocking control in assays to test for specificity of this FLJ20489 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FLJ20489 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details

Target: FLJ20489

Background: FLJ20489 is a heme transporter that regulates intracellular heme availability through the endosomal or lysosomal compartment.

Molecular Weight: 26 kDa (MW of target protein)