SLC38A3 antibody (N-Term)

Catalog No. ABIN635610

This anti-SLC38A3 antibody is a Rabbit Polyclonal antibody detecting SLC38A3 in WB. Suitable for Human and Mouse.

Quick Overview for SLC38A3 antibody (N-Term) (ABIN635610)

Target: SLC38A3 (Solute Carrier Family 38 Member 3 (SLC38A3))

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLC38A3 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-SLC38A3 Antibody

Binding Specificity: N-Term

Specificity: SLC38 A3 antibody was raised against the N terminal of SLC38 3

Purification: Affinity purified

Immunogen: SLC38 A3 antibody was raised using the N terminal of SLC38 3 corresponding to a region with amino acids GNQRVEDPARSCMEGKSFLQKSPSKEPHFTDFEGKTSFGMSVFNLSNAIM

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLC38A3 Blocking Peptide, (ABIN938842), is also available for use as a blocking control in assays to test for specificity of this SLC38A3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC30 3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SLC38A3

Target: SLC38A3 (Solute Carrier Family 38 Member 3 (SLC38A3))

Alternative Name: SLC38A3

Background: As a sodium-dependent amino acid/proton antiporter, SLC38A3 mediates electrogenic cotransport of glutamine and sodium ions in exchange for protons. It also recognises histidine, asparagine and alanine. It may mediate amino acid transport in either direction under physiological conditions and play a role in nitrogen metabolism and synaptic transmission.

Molecular Weight: 56 kDa (MW of target protein)