TRAM1L1 antibody (Translocation Associated Membrane Protein 1-Like 1) (Middle Region)

Catalog No. ABIN635623

Product Details anti-TRAM1L1 Antibody

Target:

TRAM1L1

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TRAM1L1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: TRAM1 L1 antibody was raised against the middle region of TRAM1 1

Purification: Affinity purified

Immunogen: TRAM1 L1 antibody was raised using the middle region of TRAM1 1 corresponding to a region with amino acids LWAIVFILGRLVTLIVSVLTVGFHLAGSQNRNPDALTGNVNVLAAKIAVL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TRAM1L1 Blocking Peptide, catalog no. 33R-5552, is also available for use as a blocking control in assays to test for specificity of this TRAM1L1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRAM0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TRAM1L1

Target:

TRAM1L1

Alternative Name: TRAM1L1 (TRAM1L1 Antibody Abstract)

Synonyms: A830091N21Rik, translocation associated membrane protein 1-like 1, TRAM1L1, Tram1l1

Background: TRAM1L1 is stimulatory or required for the translocation of secretory proteins across the ER membrane.

Molecular Weight: 42 kDa (MW of target protein)