SAMD8 antibody (Middle Region)

Catalog No. ABIN635629

This Rabbit Polyclonal antibody specifically detects SAMD8 in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for SAMD8 antibody (Middle Region) (ABIN635629)

Target: SAMD8 (Sterile alpha Motif Domain Containing 8 (SAMD8))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SAMD8 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-SAMD8 Antibody

Binding Specificity: Middle Region

Specificity: SAMD8 antibody was raised against the middle region of SAMD8

Purification: Affinity purified

Immunogen: SAMD8 antibody was raised using the middle region of SAMD8 corresponding to a region with amino acids MQTYPPLPDIFLDSVPRIPWAFAMTEVCGMILCYIWLLVLLLHKHRSILL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SAMD8 Blocking Peptide, (ABIN5615996), is also available for use as a blocking control in assays to test for specificity of this SAMD8 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SAMD8 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SAMD8

Target: SAMD8 (Sterile alpha Motif Domain Containing 8 (SAMD8))

Alternative Name: SAMD8

Background: SAMD8 is a multi-pass membrane protein. It belongs to the sphingomyelin synthase family and contains 1 SAM (sterile alpha motif) domain. The function of the SAMD8 protein remains unknown.

Molecular Weight: 36 kDa (MW of target protein)