SLC6A2 antibody

Catalog No. ABIN635638

This Rabbit Polyclonal antibody specifically detects SLC6A2 in WB. It exhibits reactivity toward Human, Rat and Mouse.

Quick Overview for SLC6A2 antibody (ABIN635638)

Target: SLC6A2 (Solute Carrier Family 6 (Neurotransmitter Transporter, Noradrenalin), Member 2 (SLC6A2))

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLC6A2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-SLC6A2 Antibody

Purification: Affinity purified

Immunogen: SLC6 A2 antibody was raised using a synthetic peptide corresponding to a region with amino acids STLSGSTFWAVVFFVMLLALGLDSSMGGMEAVITGLADDFQVLKRHRKLF

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLC6A2 Blocking Peptide, (ABIN5616273), is also available for use as a blocking control in assays to test for specificity of this SLC6A2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC0 2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SLC6A2

Target: SLC6A2 (Solute Carrier Family 6 (Neurotransmitter Transporter, Noradrenalin), Member 2 (SLC6A2))

Alternative Name: SLC6A2

Background: The SLC6A2 gene encodes a norepinephrine (noradrenaline) transporter, which is responsible for reuptake of norepinephrine into presynaptic nerve terminals and is a regulator of norepinephrine homeostasis.

Molecular Weight: 69 kDa (MW of target protein)