C5ORF4 antibody (N-Term)

Catalog No. ABIN635643

This anti-C5ORF4 antibody is a Rabbit Polyclonal antibody detecting C5ORF4 in WB and IHC. Suitable for Human and Dog.

Quick Overview for C5ORF4 antibody (N-Term) (ABIN635643)

Target: C5ORF4 (FAXDC2) (Fatty Acid Hydroxylase Domain Containing 2 (FAXDC2))

Reactivity: Human, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This C5ORF4 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-C5ORF4 Antibody

Binding Specificity: N-Term

Specificity: C5 ORF4 antibody was raised against the N terminal Of C5 rf4

Purification: Affinity purified

Immunogen: C5 ORF4 antibody was raised using the N terminal Of C5 rf4 corresponding to a region with amino acids MKGEAGHMLHNEKSKQEGHIWGSMRRTAFILGSGLLSFVAFWNSVTWHLQ

Application Details

Application Notes: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C5ORF4 Blocking Peptide, (ABIN5612527), is also available for use as a blocking control in assays to test for specificity of this C5ORF4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for C5ORF4

Target: C5ORF4 (FAXDC2) (Fatty Acid Hydroxylase Domain Containing 2 (FAXDC2))

Alternative Name: C5ORF4

Background: C5ORF4 is involved in the fatty acid biosynthetic process.

Molecular Weight: 21 kDa (MW of target protein)