STOML3 antibody

Catalog No. ABIN635649

The Rabbit Polyclonal anti-STOML3 antibody (ABIN635649) specifically detects STOML3 in WB. The antibody is reactive with Human, Mouse and Rat samples.

Quick Overview for STOML3 antibody (ABIN635649)

Target: STOML3 (Stomatin (EPB72)-Like 3 (STOML3))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This STOML3 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-STOML3 Antibody

Purification: Affinity purified

Immunogen: STOML3 antibody was raised using a synthetic peptide corresponding to a region with amino acids SFLLVIITFPISIWMCLKIIKEYERAVVFRLGRIQADKAKGPGLILVLPC

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

STOML3 Blocking Peptide, (ABIN5616443), is also available for use as a blocking control in assays to test for specificity of this STOML3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of STOML3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for STOML3

Target: STOML3 (Stomatin (EPB72)-Like 3 (STOML3))

Alternative Name: STOML3

Background: The function of STOML3 protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 32 kDa (MW of target protein)