DPY19L2 antibody

Catalog No. ABIN635657

The Rabbit Polyclonal anti-DPY19L2 antibody has been validated for WB. It is suitable to detect DPY19L2 in samples from Human and Rat.

Quick Overview for DPY19L2 antibody (ABIN635657)

Target: DPY19L2 (Dpy-19-Like 2 (DPY19L2))

Reactivity: Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DPY19L2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-DPY19L2 Antibody

Purification: Affinity purified

Immunogen: DPY19 L2 antibody was raised using a synthetic peptide corresponding to a region with amino acids IIGEFNNLPQEELLQWIKYSTTSDAVFAGAMPTMASIKLSTLHPIVNHPH

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DPY19L2 Blocking Peptide, (ABIN939384), is also available for use as a blocking control in assays to test for specificity of this DPY19L2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DPY10 2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DPY19L2

Target: DPY19L2 (Dpy-19-Like 2 (DPY19L2))

Alternative Name: DPY19L2

Background: The function of DPY19L2 has not been widely studied, and is yet to be fully elucidated.

Molecular Weight: 87 kDa (MW of target protein)