TMEM63B antibody (Middle Region)

Catalog No. ABIN635674

This Rabbit Polyclonal antibody specifically detects TMEM63B in WB. It exhibits reactivity toward Human.

Quick Overview for TMEM63B antibody (Middle Region) (ABIN635674)

Target: TMEM63B (Transmembrane Protein 63B (TMEM63B))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TMEM63B antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-TMEM63B Antibody

Binding Specificity: Middle Region

Specificity: TMEM63 B antibody was raised against the middle region of TMEM63

Purification: Affinity purified

Immunogen: TMEM63 B antibody was raised using the middle region of TMEM63 corresponding to a region with amino acids VRGCEQVEAIEYYTKLEQKLKEDYKREKEKVNEKPLGMAFVTFHNETITA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TMEM63B Blocking Peptide, (ABIN5616686), is also available for use as a blocking control in assays to test for specificity of this TMEM63B antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM60 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TMEM63B

Target: TMEM63B (Transmembrane Protein 63B (TMEM63B))

Alternative Name: TMEM63B

Background: TMEM63B belongs to the SPO75/TMEM63 family. It is a multi-pass membrane protein. The function of TMEM63B remains unknown.

Molecular Weight: 95 kDa (MW of target protein)