IgK antibody (N-Term)

Catalog No. ABIN635685

This anti-IgK antibody is a Rabbit Polyclonal antibody detecting IgK in WB. Suitable for Human.

Quick Overview for IgK antibody (N-Term) (ABIN635685)

Target: IgK (Immunoglobulin kappa (IgK))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This IgK antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-IgK Antibody

Binding Specificity: N-Term

Specificity: PIGK antibody was raised against the N terminal of PIGK

Purification: Affinity purified

Immunogen: PIGK antibody was raised using the N terminal of PIGK corresponding to a region with amino acids SVYRSVKRLGIPDSHIVLMLADDMACNPRNPKPATVFSHKNMELNVYGDD

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PIGK Blocking Peptide, (ABIN5615367), is also available for use as a blocking control in assays to test for specificity of this PIGK antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PIGK antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for IgK

Target: IgK (Immunoglobulin kappa (IgK))

Alternative Name: IGK

Background: PIGK is a member of the cysteine protease family C13 that is involved in glycosylphosphatidylinositol (GPI)-anchor biosynthesis. The GPI-anchor is a glycolipid found on many blood cells and serves to anchor proteins to the cell surface. PIGK is a member of the multisubunit enzyme, GPI transamidase and is thought to be its enzymatic component. GPI transamidase mediates GPI anchoring in the endoplasmic reticulum, by catalyzing the transfer of fully assembled GPI units to proteins.

Molecular Weight: 43 kDa (MW of target protein)