LRCH4 antibody

Catalog No. ABIN635689

This Rabbit Polyclonal antibody specifically detects LRCH4 in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for LRCH4 antibody (ABIN635689)

Target: LRCH4 (Leucine-Rich Repeats and Calponin Homology (CH) Domain Containing 4 (LRCH4))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LRCH4 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-LRCH4 Antibody

Purification: Affinity purified

Immunogen: LRCH4 antibody was raised using a synthetic peptide corresponding to a region with amino acids LEEAVATGTLNLSNRRLKHFPRGAARSYDLSDITQADLSRNRFPEVPEAA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

LRCH4 Blocking Peptide, (ABIN940273), is also available for use as a blocking control in assays to test for specificity of this LRCH4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LRCH4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for LRCH4

Target: LRCH4 (Leucine-Rich Repeats and Calponin Homology (CH) Domain Containing 4 (LRCH4))

Alternative Name: LRCH4

Background: LRCH4 is a protein that contains leucine-rich repeats (LRR) at its amino terminus and that is known to be involved in ligand binding. The carboxyl terminus may act as a membrane anchor. Identified structural elements suggest that this protein resembles a receptor.

Molecular Weight: 73 kDa (MW of target protein)