ALDH3A2 antibody (C-Term)

Catalog No. ABIN635691

This anti-ALDH3A2 antibody is a Rabbit Polyclonal antibody detecting ALDH3A2 in WB and IHC. Suitable for Human, Rat and Mouse.

Quick Overview for ALDH3A2 antibody (C-Term) (ABIN635691)

Target: ALDH3A2 (Aldehyde Dehydrogenase 3 Family, Member A2 (ALDH3A2))

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ALDH3A2 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-ALDH3A2 Antibody

Binding Specificity: C-Term

Specificity: ALDH3 A2 antibody was raised against the C terminal of ALDH3 2

Purification: Affinity purified

Immunogen: ALDH3 A2 antibody was raised using the C terminal of ALDH3 2 corresponding to a region with amino acids FINEREKPLALYVFSHNHKLIKRMIDETSSGGVTGNDVIMHFTLNSFPFG

Application Details

Application Notes: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ALDH3A2 Blocking Peptide, (ABIN938319), is also available for use as a blocking control in assays to test for specificity of this ALDH3A2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ALDH0 2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ALDH3A2

Target: ALDH3A2 (Aldehyde Dehydrogenase 3 Family, Member A2 (ALDH3A2))

Alternative Name: ALDH3A2

Background: Aldehyde dehydrogenase isozymes are thought to play a major role in the detoxification of aldehydes generated by alcohol metabolism and lipid peroxidation. This gene product catalyzes the oxidation of long-chain aliphatic aldehydes to fatty acid. Mutations in the gene cause Sjogren-Larsson syndrome.

Molecular Weight: 53 kDa (MW of target protein)