PSMA antibody

Catalog No. ABIN635723

Product Details anti-PSMA Antibody

Target: PSMA (FOLH1) (Folate Hydrolase (Prostate-Specific Membrane Antigen) 1 (FOLH1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PSMA antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: FOLH1 antibody was raised using a synthetic peptide corresponding to a region with amino acids FYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FOLH1 Blocking Peptide, catalog no. 33R-3141, is also available for use as a blocking control in assays to test for specificity of this FOLH1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FOLH1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PSMA

Target: PSMA (FOLH1) (Folate Hydrolase (Prostate-Specific Membrane Antigen) 1 (FOLH1))

Alternative Name: FOLH1 (FOLH1 Products)

Synonyms: FGCP antibody, FOLH antibody, GCP2 antibody, GCPII antibody, NAALAD1 antibody, NAALAdase antibody, PSM antibody, PSMA antibody, mGCP antibody, mopsm antibody, Naalad antibody, putative N-acetylated-alpha-linked acidic dipeptidase antibody, folate hydrolase 1B antibody, folate hydrolase 1 antibody, folate hydrolase (prostate-specific membrane antigen) 1 antibody, LOC451185 antibody, FOLH1B antibody, FOLH1 antibody, Folh1 antibody

Background: FOLH1 is a type II transmembrane glycoprotein belonging to the M28 peptidase family. The protein acts as a glutamate carboxypeptidase on different alternative substrates, including the nutrient folate and the neuropeptide N-acetyl-l-aspartyl-l-glutamate and is expressed in a number of tissues such as prostate, central and peripheral nervous system and kidney. Expression of this protein in the brain may be involved in a number of pathological conditions associated with glutamate excitotoxicity.

Molecular Weight: 84 kDa (MW of target protein)